Repbase Reports |
---|
2003, Volume 3, Issue 4 |
April 30, 2003 |
Copyright © 2001-2024 - Genetic Information Research Institute, California |
ISSN# 1534-830X |
Page 84 |
Tc1-1_AG |
|||
---|---|---|---|
Tc1-1_AG is an autonomous DNA transposon - a consensus sequence. |
|||
Submitted: 08-May-2003 |
Accepted: 08-MAY-2003 |
||
Key Words: Mariner/Tc1; DNA transposon; Transposable Element; Tc1-1_AG; Topi; Autonomous DNA transposon; mariner/Tc1 superfamily |
|||
Source: Anopheles gambiae |
Organism: Anopheles gambiae |
Taxonomy: Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Holometabola; Diptera; Nematocera; Culicoidea; Culicidae; Anophelinae; Anopheles |
|
[] |
Authors: Kapitonov,V.V. and Jurka,J. |
||
Title: Tc1-1_AG, a family of autonomous mariner/Tc1-like DNA transposons from African malaria mosquito. |
|||
Journal: Repbase Reports 3(4), 84-84 (2003) |
|||
Abstract: There are ~50 copies of Tc1-1_AG in the genome. They are ~98% identical to the consensus sequence. This element has 24-bp terminal inverted repeats. This transposon is inserted preferentially into the GTAC target site (the TA target site duplication). Tc1-1_AG encodes the 332-aa Tc1-1_AGp transposase (pos. 272-1267). RADPFKTCTRIKQELGLQVSAKTVSRRLHAAGFCARRPRKVRKLxPHHVEARIRFAEEHLAASIFWWSKI IFSDESRINLDGSDGIKYVWRFPNQAYHPKNTIKTLSHGGGHVMVWGCFSWHGTGPLFRINGTLNSEGYR KILSRKMLPYARQQFGDEEHYIFQHDNDSKHTSRTVKCYLANQDVQVLPWPALSPDLNPIENLWSTLKRQ LKNQPARSADDLWTRCKVMWERIxRSECRNLIGDMAKRCQEVIANNGHQIDR.
|
|||
Derived: [1] (Consensus) |
|||
Download Sequence - Format: IG, EMBL, FASTA |
|||
References:
|