Repbase Reports |
|---|
| 2003, Volume 3, Issue 5 |
| May 31, 2003 |
| Copyright © 2001-2024 - Genetic Information Research Institute, California |
| ISSN# 1534-830X |
| Page 95 |
Merlin1m_CE |
|||
|---|---|---|---|
Nonautonomous DNA transposon Merlin1m_CE. |
|||
|
Submitted: 16-Jun-2003 |
Accepted: 16-JUN-2003 |
||
|
Key Words: Merlin; DNA transposon; Transposable Element; Nonautonomous; 8-bp TSD; Merlin/IS1016 superfamily; Merlin1m_CE; nonautonomous DNA transposon |
|||
|
Source: Caenorhabditis elegans |
Organism: Caenorhabditis elegans |
Taxonomy: Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis |
|
| [] |
Authors: Feschotte,C. and Wessler,R.S. |
||
|
Title: Merlin1m_CE, a nonautonomous family of Merlin/IS1016-like DNA transposons from the the nematode C. elegans. |
|||
|
Journal: Repbase Reports 3(5), 95-95 (2003) |
|||
Abstract: Merlin1m_CE contains a short stretch of coding sequences (41 aa, VEIDESLFSKRKNNSGRILPQLWIFGGICRETGEFFLTEVD) with 46% identity (60% similarity) to the Merlin1_CB transposase (from nematode C. briggsae). Merlin1m_CE TIRs are very similar to those of elements from the PAL8C families. Presumably, PAL8C_1-PAL8C_5 belong also to the Merlin group of DNA transposons.
|
|||
|
Derived: Positions 40499 40112 Accession No AF003130 Genbank |
|||
|
Download Sequence - Format: IG, EMBL, FASTA |
|||
|
References: |
|||